CCL4 (C-C motif chemokine ligand 4), Human
CCL4 act as an important pro-inflammatory cytokine during acute and chronic inflammatory responses. CCL4 also play a role as an attractant NK cells, dendritic cells, monocytes, and lymphocytes to sites of injury and inflammation. As CCL4 conducts signaling through G-protein-coupled receptor CCR5, which is a major co-receptor for M-tropic HIV strains. Thus, binding of CCL4 to CCR5 inhibits HIV entry and reduces the cell surface expression of CCR5. CCL4 has been identified as one of the major anti-HIV factors produced by CD8+ T cells.
Sequence:
APMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
UnitProt ID:
Q8NHW4
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <10 ng/mL.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
APMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
UnitProt ID:
Q8NHW4
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <10 ng/mL.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
Reviews for CCL4 (C-C motif chemokine ligand 4), Human
Average Rating: 0 (0 Reviews )